DPCstruct | MC5811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523ELY1 | 1-81 | MHRLGVYAVLGRSFKTTNCLESVNALVEERCAKIDHWKNSSQRQHWLITALVDIEPRLRKVVGYRHLPKLREALKRELKHR |
| A0A7M2YSQ5 | 25-131 | NPDAAASLREGLAETLTINRLGVTGTLLKTVMSTNPVESMIEIVRAHARNVKRWQNGDMRLRWAAAGMTAAHTQFRRVKGYRQLPQL… |
| A0A1F9TYY3 | 235-344 | None |
| A0A7V2UAY7 | 11-117 | None |
| A0A2T2SCG1 | 57-175 | None |
| A0A161M6N3 | 3-112 | None |
| A0A4P6PE83 | 22-134 | None |
| A0A6I0ECX0 | 96-200 | None |
| A0A7K0A9R3 | 2-93 | None |
| A0A7X2PRB6 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.