DPCstruct | MC58107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1483 |
|---|---|
| Mean domain length (aa) | 299 ± 67 aa |
| Standard deviation of domain lengths | 66.52 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.38 |
| Mean intra-cluster sequence similarity (%) | 13.67 |
| Pfam Score | 95.09 |
| Assigned Pfam label(s) | PF03747- CL0126- CL0063- CL0244- CL0083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A169NVV6 | 3-267 | SVTGRDGRWSGTAGEWRGPVEEDFAIGSVTKLFTSAVVLQLVGEGRLSLDDTVQEVLPDLLPEGYEPITLAQLLSHTSGLQQPSCVR… |
| M4T5Q0 | 1-170 | MTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLAS… |
| A0A2V7Y2H2 | 8-332 | None |
| A0A2N6CFM4 | 270-538 | None |
| A0A399Z879 | 73-316 | None |
| A0A1V8T2K3 | 51-455 | None |
| A0A1B0C4W6 | 217-476 | None |
| A0A399EPW1 | 64-334 | None |
| A0A4U0Y001 | 8-291 | None |
| A0A1C4KKC8 | 133-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.