DPCstruct | MC58102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 331 ± 48 aa |
| Standard deviation of domain lengths | 48.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5WXS1 | 22-252 | LANVHVPRGTTVNEIRVLGQDVRVDGRARGPVLIVGGNLTVGPTGQASDVTVIGGSIRTAPGGRLGGDVFQFGGEIPDLSGWRLAAA… |
| A0A2W4MBX7 | 54-349 | PEVIVTGRVGGALRASGGSVTVVGEIAGDVVAATWTLTFGQEATVGGEVLYWGRRLSFAGTVSGDIRGSASRVELAGTVGRNVEVSA… |
| A0A6L7UG66 | 92-460 | None |
| A0A661U4S6 | 15-336 | None |
| A0A524PFV6 | 95-304 | None |
| A0A7Y5QXH0 | 111-419 | None |
| A0A1B7LCV2 | 459-791 | None |
| A0A7C2GBM2 | 198-500 | None |
| A0A4U1JFN9 | 145-445 | None |
| A0A4R5Y264 | 22-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.