DPCstruct | MC5810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.21 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 54.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5RHX0 | 1-79 | MNPDLVVRDQKGKPYSVRYDQVNAMLFNEFLKEHSKVERLEATVASLAAMVTEQAARLQIVHATLGVDKSATKVASTKR |
| A0A2V6MKR0 | 33-103 | IAEEVEKMNPDLVVRDESGKAMTVRYDAVNAMLLNEFLKEHNEVERLKAGVAQQQKQIEALTASLRELANQ |
| A0A2V6C382 | 47-137 | None |
| A0A7W1RPB2 | 1-80 | None |
| A0A7W1RPP2 | 51-131 | None |
| A0A2V5KVN9 | 82-166 | None |
| A0A7W1MT44 | 33-116 | None |
| A0A2V5T6P3 | 106-184 | None |
| A0A2V5SRI5 | 310-394 | None |
| A0A2V5MQA2 | 208-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.