DPCstruct | MC581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 149 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 28.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813T0V5 | 268-409 | LKESCSMQMVFFPGNILLHDHIRFAYFTNQTIIRRRTEVQSLPDYICYSLERCPFLKFSFHYNGSVCASLLDLSVKSLLEIDLLFRT… |
| A0A819JNA1 | 1-143 | MPVSTFTLFKHVSLFYNDTIPKWICYNETLCPYLTMNEFNLSKSHILNGSICRASNVFNNKIYTDLKDIFKEFKRFVRSCALPPNIH… |
| A0A821HYJ4 | 327-485 | None |
| A0A820QQY0 | 330-495 | None |
| A0A814GRC8 | 3-153 | None |
| A0A816YVD5 | 94-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.