DPCstruct | MC58098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 4.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 48.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7H244 | 387-453 | VPPETRDQARADNAAADSRRSPTGGDYGPDTCLSGYIWRLVTPSDLVCVTPETHDQVEEDNSLAASR |
| A0A391PBE6 | 58-127 | VKPGVRDSTAQENANPDLHRQPGGGAYGPDTCASGYVWREAFGGDHVCVSPAVRQQASNDNAKAESRYQR |
| A0A7Y0QQ87 | 88-156 | None |
| A0A818M5S0 | 1-82 | None |
| A0A7I7SHW0 | 57-123 | None |
| A0A1H6VP89 | 261-327 | None |
| A0A1G3XYQ8 | 58-134 | None |
| A0A7I7NYB2 | 49-110 | None |
| X5UZX4 | 158-223 | None |
| A0A1W6MRK6 | 66-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.