DPCstruct | MC58097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 15.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A366LSL2 | 1-133 | MGAPGRDAEITAMRRQHSTLQPAAGLIVFHTRLGLTMIDLIEGLGERASIIARLIDTVLAAGDGYAARDLLAHQACRAALTPAQQNT… |
| A0A285QW15 | 141-270 | VTAVLTALCRPGDQRAVKRAIDHCLTFEPDEGLAVFTTRLALTALDAADLDTPAARNLLAHLTSRTGASGDGYALRDLLTHEGVRRR… |
| A0A652NX92 | 72-226 | None |
| A0A5R8P410 | 2-114 | None |
| A0A401VXF5 | 1-153 | None |
| A0A1I1YV07 | 90-217 | None |
| K4QSP4 | 50-198 | None |
| A0A4D4JHU6 | 138-283 | None |
| A0A365YP86 | 235-402 | None |
| E3J6B5 | 134-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.