DPCstruct | MC58094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 278 ± 46 aa |
| Standard deviation of domain lengths | 45.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0WDS3 | 9-253 | APIATAVVRLTDVAPDGTSAQVTAGILNLTHRGSHADPSPLETGVATEMRVPMRGTAYRFLAGHRIRVSIASASWPAIWPAPYEAEY… |
| Q0TVT8 | 199-493 | LGFAGGRWLTFGVEGEGPSDQRLEAGGSLVFDTRPLTESIDLLGAAVLNVRIASDKPYALLAATLSEILPNGAATRVSYGLLNLTHR… |
| A0A819SR09 | 146-432 | None |
| A0A819KNT4 | 266-546 | None |
| A0A7W1GSI2 | 1-276 | None |
| A0A6S7IDY3 | 56-368 | None |
| A0A2U3L2M9 | 1-195 | None |
| A0A7Y3AM75 | 72-398 | None |
| A0A538I542 | 96-294 | None |
| A0A1S3JQI4 | 740-1084 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.