DPCstruct | MC58093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 120 ± 31 aa |
| Standard deviation of domain lengths | 30.82 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.58 |
| Pfam Score | 61.99 |
| Assigned Pfam label(s) | CL0123- CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0UEM5 | 21-141 | AYLALVGPEELPAEGPAEREAGWHPVDDLPELALDHETIVDDGLWRLRARVTEKTWFLRIAGALLPAAFTLGQAQRLYAALAGEAVD… |
| A0A3M5DLV3 | 44-156 | DTRVEDDDLDFVPLRDVRSERFALPFDHAQLVQQACERLASKSVYSALPLFLLAPRFTVAEALKAFECAIGQEVQHSSLRGRLERMK… |
| A0A127Q570 | 9-100 | None |
| A0A7W0W2K8 | 5-77 | None |
| A0A7C1FUU5 | 340-481 | None |
| A0A661A6G8 | 27-146 | None |
| A0A7G7BGD0 | 316-469 | None |
| A0A6G3VDY1 | 4-98 | None |
| A0A653ZT15 | 3-67 | None |
| A0A2S8BCR9 | 9-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.