DPCstruct | MC58091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 386 ± 99 aa |
| Standard deviation of domain lengths | 99.03 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0UBJ0 | 62-424 | LLVSAHEPEPVLFSTRWAMSYLRGPLTKEQIETLMQNVPRPAPAAAPPVETPADATPVAPAVAAGVPTRYVDPAAPWLPLVAGTPGG… |
| A0A3N5XP68 | 2-259 | KHYKLRSDELTEVPSLLFEIKIDMQDLRSGYRYSDWGLFFRAPWIDDYDLEWTADMVKWLNGTDLVEMPAKTALTWPQLADQKAVRY… |
| A0A7X8VGD0 | 174-631 | None |
| A0A1V6DIE3 | 131-515 | None |
| A0A7X7HXZ8 | 1-285 | None |
| A0A662HGQ0 | 15-299 | None |
| A0A850SA99 | 181-731 | None |
| A0A2W4K4X0 | 368-836 | None |
| A0A2U3CC95 | 299-806 | None |
| A0A7J3VAY8 | 292-722 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.