DPCstruct | MC58090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 351 ± 76 aa |
| Standard deviation of domain lengths | 75.55 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5EYN8 | 489-912 | VSSLYRQARIARLFALTVEDSQWLLALLGGAEFRRLVAKGQMLSRDAAPGVDVLDVLMRMDWTVRWLTSHKLTVAALRALLDSTGTT… |
| A0A0Q0I1K5 | 122-581 | DGSTLYLDQHSSQHVKARAQLSRALHLSSTHEGLRQLAIDVRELIGNAPTDFRLNLSMISSLYRQARIASMFGLTTAECRALIDLLG… |
| A0A484WWW2 | 4-238 | None |
| A0A3Q9D7C1 | 155-478 | None |
| A0A5B0EUK3 | 629-970 | None |
| A0A109LLE5 | 326-744 | None |
| A0A6G6ETA1 | 545-950 | None |
| A0A5E7B535 | 55-320 | None |
| A0A6L5HPK9 | 56-320 | None |
| A0A0L0LVQ0 | 94-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.