DPCstruct | MC5809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0A3R5 | 1-61 | MSGCDARQKSLEYYTEFARQLPKDTIILTSGCAKYRYNKLKLGDIGGIPRVIDAGQCNDSY |
| A7ACZ9 | 1-79 | MAGCDGRMKKRNYYTEFAEQLPDDCVILTAGFAKYRYNKLSLGDINGIPRVLDTGQCNDSYSLALTAMKLQDVFGLEGM |
| A0A812J9V6 | 441-500 | None |
| W4FBH1 | 70-141 | None |
| S4YBQ3 | 16-89 | None |
| A0A0V0QJA2 | 538-632 | None |
| A0A2J8ABA3 | 697-772 | None |
| A0A843DR26 | 123-197 | None |
| A0A3B9K8G9 | 363-452 | None |
| M5E2C5 | 879-955 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.