DPCstruct | MC58088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 576 ± 90 aa |
| Standard deviation of domain lengths | 90.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03538 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1W5D0 | 24-660 | DRFNAALLALDIHSVFDIIRFSRNDFIDRLAKHCDEDGGQAYDNAVGYASKIELLARTPSLRDPDMLRNKRGSTSDPHAPPTYATLF… |
| A0A2S8Q5F6 | 1-398 | MANKIESRINYKTLFNDNQDLYCFPGLPEANDGPLAYLVDLYQQSCLFEEDADKKSARLLSQRRPDIEKLLLDGANLNQTSQSLPLV… |
| A0A5B0EUK3 | 2-452 | None |
| A0A6G6ETA1 | 70-698 | None |
| A0A3M3ZFI0 | 1-592 | None |
| A0A1H0MPB9 | 15-617 | None |
| A0A0L0LZ72 | 30-676 | None |
| A0A6L5HPS9 | 47-612 | None |
| A0A0E1NVV8 | 7-429 | None |
| A0A1S8A8C6 | 222-883 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.