DPCstruct | MC58087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 401 ± 85 aa |
| Standard deviation of domain lengths | 84.99 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12576 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3WNV3 | 46-482 | TLLERILADKRLSAEEQQQMAALAEMLQARIHFEFLELGERVKALYDPFDPDRDTLPLQPADRSGHRLAGEPLPGQVPVQGVAGAGA… |
| A0A6P4UDG1 | 7-342 | DSRALAKEFHSSPADKAALELFAAHVDFCTLFHYHHILARLQALYDPINPDRETLDQPSLTDPQRLSNEQEVLQALEPLLAQANFSP… |
| A0A287MF24 | 19-440 | None |
| L8H345 | 97-574 | None |
| A0A6J1GQA1 | 74-458 | None |
| A0A267G617 | 37-302 | None |
| A0A2W4ZKF8 | 194-592 | None |
| A0A0E0JT61 | 10-494 | None |
| B7GD64 | 399-725 | None |
| A0A4S2LF96 | 37-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.