DPCstruct | MC58085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3SHF7 | 3-72 | HARNFLDCIKTRQKPNADVEEGHRSTTMSLLANISLVVGQRLEWDAQNEKIISPKEANDLLHYEYRKPWS |
| A0A847XP79 | 33-103 | HVKDHLDCIRKRNFNTKANPEIASHIAKFSAVGNIAYRTGKKLIWDGTRFVNDEEANNYLVPQYREPWVLP |
| A0A6C2TXN2 | 279-348 | None |
| M5R901 | 11-106 | None |
| R5J6N0 | 96-187 | None |
| A0A2E3MNT7 | 50-130 | None |
| A0A357TJ29 | 39-109 | None |
| A0A848WZU1 | 82-178 | None |
| A0A7X9JUA8 | 93-186 | None |
| A0A368B9D8 | 70-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.