DPCstruct | MC58082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 149 ± 23 aa |
| Standard deviation of domain lengths | 22.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3LME9 | 31-178 | EIYTGRGKKRRLVTSIEILSPANKTPGEHGAELFRQKQEELAASKVNLVEIDLLRGGEHTTAVPREELIDQAGACDYHVCCWRFNRF… |
| A0A5C6A4H6 | 114-255 | VLRHVSGDDVVGFIEIVSPGNKHSQSSIRQLIDKIGDAVARGCHVLVVDLHGPTPRDQRGLHAQYWMDWYADPTAPGVTKECPLGLA… |
| A0A517XZ09 | 1-176 | None |
| A0A7C3KWD8 | 158-330 | None |
| A0A7X6CIB9 | 6-147 | None |
| A0A1W9X4A9 | 5-120 | None |
| A0A3A0B121 | 113-270 | None |
| A0A2W4X1R1 | 22-133 | None |
| A0A2V8MTR9 | 181-317 | None |
| A0A354GYF8 | 43-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.