DPCstruct | MC5808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 292 ± 40 aa |
| Standard deviation of domain lengths | 39.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4ZFH7 | 41-317 | HLDDERARVWLRLEFRALATALRSRGRARENATREALMFRATRHAAYPNAAATEAALDRNEGLAAYTGVKLGAGDNADLYAARTLDD… |
| A0A3S4SM51 | 11-268 | TDAANRQEHLGRARYWQDMWTSTYAKDAEAIRTYDIREGVARYLERAGDYVDPALSGEELTKAQTAGLEYQFDTSIDGESYSLGFVS… |
| A0A1I1PFJ4 | 2-259 | None |
| M2BH93 | 286-628 | None |
| A0A1H1V4M9 | 16-274 | None |
| A0A847C5K3 | 3-215 | None |
| A0A848QE13 | 2-247 | None |
| D2B4F0 | 263-556 | None |
| A0A7C3N665 | 298-616 | None |
| A0A7X6W187 | 270-613 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.