DPCstruct | MC58075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 267 ± 31 aa |
| Standard deviation of domain lengths | 31.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 44.66 |
| Pfam Score | 90.62 |
| Assigned Pfam label(s) | CL0023- CL0357- CL0229- CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672KN71 | 1-245 | MLQPNQHEHARSKDPVKYGELVILGYNGSLPGGDRGRKRSRFALHRRTKANGVKPSAVHILSNPHDSKAVNSRGQHSISFTLSRSQT… |
| A0A336LUU0 | 4-242 | RYNGFLPQGDRGRRRSKFVLYKRSDSNGVKRSKHYIVQSPQTSQAILDTTQHSISYTLSRNQAVIVEYKEDPDTDMFQVGRSSEAPI… |
| A0A7R9P9Z9 | 1-292 | None |
| A0A654H2D3 | 4-282 | None |
| A0A834XKW6 | 108-373 | None |
| A0A6S8UDS2 | 27-307 | None |
| A0A7S4E7U7 | 28-292 | None |
| A0A6J0C7B9 | 52-329 | None |
| K1PZU3 | 324-593 | None |
| B3S0L1 | 2-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.