DPCstruct | MC58074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 142 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.39 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0361- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7CJK6 | 1-128 | MSSSPTPGVPQRLHCSYCNVYFITKADLQTHCRSQDHQTTIMSDEGRDWSHRPPPRGLGAEDYTLCPTYRAAYTCRMGDQCVEAHSE… |
| A0A673G7B6 | 103-265 | ALWNVMKDENLIIPKLVKMIKQNQRTLQSKSQEKRGQFDCTLCQVHIPNVEDLMNHCFTVKHRRLIFEDTSQTWKYRDPPPTYKDQK… |
| A0A5F4WE79 | 1-146 | None |
| A0A182TCJ0 | 323-446 | None |
| A0A6F9DXI8 | 1095-1237 | None |
| A0A2G9RU73 | 78-257 | None |
| T1FZI1 | 76-214 | None |
| A0A3Q3WJU0 | 2-155 | None |
| A0A7D9NJZ3 | 852-972 | None |
| A0A4W6DFR3 | 470-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.