DPCstruct | MC58072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N4CXP3 | 298-398 | RDILPEIRAICIEEIGSWMQSYSTSFLTDSYLKYIGWTLHDKHREVRLKCLKALKGLYGNRDLTSRLELFTSRFKDRMVSMVMDREY… |
| A0A672KGB9 | 3-95 | AICIEEIGVWMKLYSDAFLNDSYLKYVGWTLHDRVSEVRLKCLKALQTLYTNRELYPKLELFTNRFKVTYMHNSEYSITAFIMSLHT… |
| A0A5J5D315 | 262-371 | None |
| A0A820LC74 | 2-81 | None |
| A0A553NLB9 | 951-1055 | None |
| A0A453HW34 | 209-309 | None |
| A0A674HAD3 | 224-325 | None |
| P0CL84 | 23-116 | None |
| R1F3Y0 | 71-187 | None |
| A0A0B1SNE5 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.