DPCstruct | MC58065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 316 ± 25 aa |
| Standard deviation of domain lengths | 25.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.09 |
| Pfam Score | 86.61 |
| Assigned Pfam label(s) | CL0003- CL0701 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672JXB0 | 1-328 | MQMAVSRVINLQHHRIAQCRTVKITILGDEGVPVQVDGEAWIQPPGYIRILHKNRTQTLTRDRAFENTLKSWEDKQRGEIPRLVSQH… |
| A0A3N0Z9A7 | 1-290 | MQMAVSRVIKLQHHRIAQCRTVKITILGDEGVPVQVDGEAWIQPPGVIKIQHKNRAQMLTRDRAFENTLKSWEDKLKYDKPPLRPHL… |
| A0A182QC48 | 933-1271 | None |
| B4I4Y1 | 1575-1913 | None |
| A0A5E4BYH6 | 290-565 | None |
| A0A7R8X479 | 386-708 | None |
| A0A481C266 | 524-846 | None |
| A0A158P7Y3 | 1-269 | None |
| A0A672L3N7 | 638-932 | None |
| A0A2K5J9I6 | 433-773 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.