DPCstruct | MC58063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9RBQ0 | 25-121 | FLVTVEQEEFTVPTWVKNIAGYWCGEEIEDSAFIQAIQYLITTNVIVIPPTNSTSTEIQPIPSWIKNTACWWSSGTITDGDFIKGIE… |
| A0A075GRD0 | 73-175 | ATSSTQFSIQDTGEVSIPFWVRDLAKMWITEPLVTDKDFGRAIEYLIEHEIIKIPYTEPEGDTITNIPDWVKTNAEWWVTGKISDTE… |
| A0A1Q7KY29 | 490-579 | None |
| A0A7K4F4L7 | 236-322 | None |
| A0A7K4DV92 | 1-82 | None |
| A0A075GWT1 | 31-134 | None |
| A0A075GX78 | 22-124 | None |
| A0A2R6TBK3 | 21-119 | None |
| A0A3R6ZQ03 | 1011-1104 | None |
| A0A2G9P1D3 | 153-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.