DPCstruct | MC5806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 238 ± 45 aa |
| Standard deviation of domain lengths | 45.07 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 38.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365MPL0 | 32-200 | VKYEAPKEFRPIEGYLTTTRKQDAETGNSHVVARRLGALFSGICPDSPNLIGAYGARVSEISKTATQKVSQEYSKSIFASYVGVDAT… |
| A0A2N3NL24 | 20-312 | ELTLAMASLNLDFTLVRLEAPKEFKGIIGGISEQRRESAESGSLHRTARKLGALFDGVPPSTPDLLAAYGTRVSEISEKAKLSPQEK… |
| A0A5Q3DTL0 | 19-291 | None |
| A0A5N6XYI3 | 3-177 | None |
| A0A484FJE8 | 1-197 | None |
| A0A072PAH2 | 339-478 | None |
| A0A2J6Q1F0 | 16-290 | None |
| A0A4Q4Y9D3 | 28-303 | None |
| A0A370TXG7 | 15-261 | None |
| A0A1L7WEG2 | 1-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.