DPCstruct | MC5805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 112 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3NH79 | 10-125 | SSFLYTLLLFLFSGRSMLAGAVLSSDAGDMSSPSPRELRPRQAAGSGCEGSEGQWNCMTDSWQRCADGIWSIEMPCSDGTICSPAGL… |
| A0A2C5WV38 | 1-96 | MASTPSELISAQAQLEGARCSPEGLWNCMTTSFQRCTSGAWSEPVAMAPGTECYPTGVTVDFQIGFSNGQGSGVDICSSMVETETTT… |
| A0A179IE70 | 281-410 | None |
| A0A420XX58 | 92-193 | None |
| A0A0F2MI62 | 25-134 | None |
| J5JI85 | 9-128 | None |
| A0A168KJ20 | 8-131 | None |
| A0A2T3B0M7 | 369-463 | None |
| A0A175W337 | 443-538 | None |
| A0A2L2TJW5 | 58-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.