DPCstruct | MC58043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 140 ± 24 aa |
| Standard deviation of domain lengths | 23.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.50 |
| Pfam Score | 90.44 |
| Assigned Pfam label(s) | CL0023- PF06470 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448X5W5 | 2-148 | RREKDEIQADRQTVYREETKIAQELHNLRDELARTEHNLRSIIGKVILNGLDSVRKVIETFRGRYGPDCDIVQGYHGTLIELIDCPE… |
| A0A833QXG0 | 22-146 | SLWKKETELKNEIDRLDSEIVKAQKNLDMAQPGDTRRGLHSVNRIIDNYNIEGVYGPILELIDCEEKFFTAVEVTAGNSLFHVVVES… |
| A0A7R9L116 | 124-219 | None |
| A0A3A5IWV2 | 2-115 | None |
| A0A183HLZ2 | 20-152 | None |
| A0A397UKK1 | 2-97 | None |
| A0A5S6Q292 | 357-496 | None |
| A0A7J6RAJ0 | 124-309 | None |
| A0A396H3E9 | 5-117 | None |
| A0A380DZS9 | 34-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.