DPCstruct | MC5803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 185 ± 39 aa |
| Standard deviation of domain lengths | 38.65 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13919 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A074YXN0 | 162-287 | MSDRLITQANSRLTKANLVTLLTKQEAWSSLDLETRRELYRMLPSTLKGDMVAIDPDMHPLKTGFAKYIKHFIYEWEQDLAAGRRTA… |
| A0A2N3NE83 | 13-176 | DQNNVHSNTQPNDQGDSARTAEPKQKPKPAKKAIPRSRWAAPKVYTHPKTPLTWNNVLNTLANPLAWDVLSAEEQKEILALFPDDEH… |
| A0A498L4D0 | 585-729 | None |
| A0A6A7BHS9 | 121-314 | None |
| A0A2Y9R1B7 | 42-243 | None |
| A0A0N1GZM9 | 1-155 | None |
| A0A7D5UPV1 | 3-163 | None |
| G2Q9E3 | 60-287 | None |
| A0A5B7A051 | 22-254 | None |
| A0A2S7P5C3 | 38-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.