DPCstruct | MC58028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 70 ± 10 aa |
| Standard deviation of domain lengths | 9.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.20 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | PF01249- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098VQN0 | 48-121 | MLNDKGEFIDLSATGRLISAKDHASVQINIAEVDENGLATGKSHPYALSGFIRSSGQADDSLNRLATSDGFLQR |
| Q4DFU6 | 6-84 | TYNEEGVNVDLYIPRKCHATNNLITSYDHSAVQIAIANVDANGVLNGTTTTFCIAGYLRRQAESDHAINHLAISKGIIR |
| A0A178VHY5 | 1-55 | None |
| A0A0B2UCQ3 | 3-67 | None |
| A0A821MCQ4 | 132-207 | None |
| A0A834DQW9 | 1-74 | None |
| M7BP49 | 1-82 | None |
| A0A4S4EGY4 | 94-167 | None |
| A0A4Y9ZC08 | 6-80 | None |
| A0A5D2WHY6 | 3-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.