DPCstruct | MC58027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 138 ± 17 aa |
| Standard deviation of domain lengths | 17.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.49 |
| Pfam Score | 76.19 |
| Assigned Pfam label(s) | PF12535- CL0261- CL0126- PF05026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098VNC9 | 3-135 | SRFIVNLPEADKLAADRLLFHLEAAHWFYDDHLRTSSEKADVYPSMKFPKFCRQMLNRDPALSHLVAEIPQLIEFFSAHKRSVPVAG… |
| A0A6J0M2A0 | 7-150 | KKLLDDLYSRFVLNGPEEEKQSLNGLMFLVESAHWYYEDDVVENDQTLKSLSFREFTCLLFNNSDVLRPYAANMDKILRDFFAYKSR… |
| A0A317XRR7 | 187-335 | None |
| Q5CYD9 | 232-371 | None |
| A0A6V7WS71 | 1-117 | None |
| A0A061DDB6 | 143-292 | None |
| A0A067BXF3 | 18-134 | None |
| B0EUT7 | 2-119 | None |
| A0A1E5RP24 | 15-162 | None |
| A0A1I8IJ48 | 28-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.