DPCstruct | MC58019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 8.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A071LR67 | 1-122 | MIGGKGEKVLHKNRAEYLRQIFDVTESSPLHDKKLRNAIEHFDERLDMYLEVGIVGHIFPSLILDKPEETDVPHHIFRAYYLNNGIY… |
| A0A3M1PVP6 | 143-255 | RGEILREKLGLPESHALGDRRFVELWDHADEKFDDWLKRTHGEQVLFDFVGPIRALNVPGLKDDGIYRLYDTETKIFVFRGVGYNMQ… |
| A0A519Q6J4 | 13-113 | None |
| A0A533BCC1 | 4-116 | None |
| A0A5A7MTZ4 | 66-182 | None |
| A0A346NQW8 | 29-135 | None |
| A0A0H2SJF0 | 3-93 | None |
| A0A7W1JW95 | 51-157 | None |
| A0A1J5PRG4 | 87-200 | None |
| A0A2V9PJ59 | 73-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.