DPCstruct | MC58009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 88 ± 21 aa |
| Standard deviation of domain lengths | 20.77 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165ZWJ8 | 2-64 | IEECMLFKMSKEECMEALSKHANILPIVTSTVWKELEKENKEFFEDYYTKRAEEKQRNVSSEL |
| A0A1U7ZZL6 | 48-135 | IAIMGDSSASYIRLVQHLIEKCILFHMTKEECVEALSKHANIKPVITSTVWKELEKENKEFFEAYTKSREGRMAEMETRQMIQKMLSD |
| M7YYX9 | 144-204 | None |
| A0A834TM42 | 166-263 | None |
| A0A2G3AU11 | 641-751 | None |
| K3WRW7 | 261-359 | None |
| A0A5S9XIB9 | 6-108 | None |
| A0A7N2L8D4 | 1-64 | None |
| F4PU63 | 13-107 | None |
| A0A1U8JY27 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.