DPCstruct | MC58003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 135 ± 25 aa |
| Standard deviation of domain lengths | 25.45 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6SL20 | 281-395 | DVRAQVSALIHPGFVTEAGLGRLGDLKRYLVAADRRLAQMPTGVQRDTTRMAKVKEMQDEYAWLLEQLPQGRPVPKEVLEIRWMIEE… |
| A0A836T6I3 | 21-134 | DIQGQLDRLIHRGFLRQLSWERLGQYPRYLRALELRLEKLRMDPARDQRWMRELQMVHEEWLGRWQAACEKGVVDERLEEIRWLLEE… |
| A0A379GIY2 | 1-99 | None |
| A0A7V7N3I8 | 427-557 | None |
| A0A349LLT8 | 15-167 | None |
| A0A7X9KMU9 | 37-171 | None |
| A0A2S5TP75 | 2-85 | None |
| A0A1J5Q4P9 | 110-241 | None |
| A0A3M6H976 | 5-100 | None |
| A0A087BPX2 | 533-684 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.