DPCstruct | MC58000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21814 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4NID2 | 8-113 | SNLVIEPEKLTEYALNLDNPVGSDKAVIFQRRLGFSQENYELLLAQMSAKALDAEGVLGLNDKHGQRYTVDLEIVGAQGQQGIVRTG… |
| A0A645A7G0 | 24-120 | SVDDKLTRYLLNADHPVGGSKAKWFKEALGYTQSNMDDLAKQIVFDPTKAVQTGVTEYGTKLNQSISITGANGKVIDVTFAWMKSAE… |
| A0A1C4YU55 | 58-170 | None |
| A0A1H4BS26 | 72-157 | None |
| A0A4Z0RZS2 | 3-112 | None |
| A0A0P4UNU5 | 1-108 | None |
| A0A2V5ZC61 | 47-121 | None |
| A0A7W1HQC2 | 23-154 | None |
| A0A240EBY4 | 248-369 | None |
| A0A5F0K4P0 | 93-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.