DPCstruct | MC580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 5.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 62.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9Y385 | 1-61 | MFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQA |
| A0A819JBX5 | 2-74 | FPYIDNIHGKWHFNEIRAIFSRRYLLQDKALEIFVSNRTSVMFAFIDRSIVKKVVNFLPRVGVGGRYGLPQQR |
| A0A212FNE6 | 81-161 | None |
| M7BV09 | 25-97 | None |
| A0A4Z2JCS3 | 1-61 | None |
| A0A1X7SSK5 | 199-276 | None |
| A0A3M7S4E8 | 7-79 | None |
| A0A183MHP7 | 159-237 | None |
| Q19317 | 1739-1811 | None |
| A0A821R765 | 71-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.