DPCstruct | MC57999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 226 ± 52 aa |
| Standard deviation of domain lengths | 51.53 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4ML47 | 99-300 | MQQKLDSMAAKDETLQQLLIWANHKSQLVQRNFKPAEIRAFYVALVCVLDLALTRVLDPSLKFDISKVRKLRKSLAKAQKNVEFADV… |
| A0A6P0KAH4 | 1-244 | MFNYANLLVQSEALQTMLDWLDRVTTAAQVKSSAWRALYFAIDLDVELYIHISPDDKINRQIAEKLAIAMREFNIERKKTTPTQPRA… |
| A0A7Y0IS29 | 1035-1253 | None |
| A0A367PY03 | 7-167 | None |
| A0A6P0WRD5 | 3-214 | None |
| A0A350XAR6 | 12-274 | None |
| A0A844MTG9 | 2-388 | None |
| T2JQK4 | 523-715 | None |
| A0A3S1BXK6 | 1-223 | None |
| Q4C5K5 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.