DPCstruct | MC57996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Standard deviation of domain lengths | 22.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 65.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4S414 | 72-213 | TLRDGHKTNRRKTQQVSPTPTTTGTTSTTTADNETPNPTTMTAPTQPRMDRTEYTPKQIQHIERKANRQKRGRDYYYYPAADNFVPI… |
| A0A5B0QRA8 | 1-150 | MMHRLGEVGNAPIPPYNPMYTENFVRNRQKIAAPGPYVGGPSMKPPTPPRMDRLASPEQQKKIDDILANYESGFSYQLTKEGQFIKL… |
| A0A0L6VS57 | 7-160 | None |
| F4S9K8 | 19-234 | None |
| F4RTM3 | 3-165 | None |
| A0A5B0QTR1 | 17-154 | None |
| A0A2S4VVH7 | 31-190 | None |
| E3K4V6 | 10-192 | None |
| A0A5B0N2W0 | 11-156 | None |
| A0A0L0UZM2 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.