DPCstruct | MC57994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 149 ± 40 aa |
| Standard deviation of domain lengths | 39.75 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4W3W3 | 1-91 | MTEKLLYIGEVISKFGLDPKRYITAFFCNENAKIVSNRRLWGAGIGWRSTQEVLHGIKGLVCKTTNGKSRWKDYILSEARIFIFTIA… |
| A0A5B0QHX0 | 3-144 | PQNVPILTEAEKGIQICDAIHHLQMTPKKFINGFLTNADPQIAYRRRFWGTSTGSSLTHGIIQAVKAEVASKGRRTGEVFHTVQPSF… |
| A0A2S4W1F4 | 9-190 | None |
| A0A2S4VT50 | 35-269 | None |
| A0A2S4VR61 | 1-94 | None |
| A0A2S4VL11 | 2-173 | None |
| A0A2S4UA98 | 6-145 | None |
| E3KQZ0 | 1-156 | None |
| E3K0F3 | 8-108 | None |
| A0A2S4WID7 | 15-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.