DPCstruct | MC57992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 169 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0Q0C9 | 1-180 | MRMRIRMCVSAEIVSGYPHPRGYPDPMRPSLALTAAKKADRDMKAAQKLETRRLNAAAKEARASMKVSEKSTPTPRFVWSDEASLEV… |
| A0A5B0PQD0 | 1-135 | MLAAPTVTLLVSENFVSLEKVTLQCSVAAHHWKQEAQRQRLAAKEARAALKVSDAGTPTPRFVWSKEASLELLRYVKEIKEEHNNLI… |
| A0A5B0PW42 | 160-325 | None |
| A0A180GKE5 | 247-427 | None |
| A0A2N5V0R6 | 1-149 | None |
| A0A2N5SJT9 | 1-149 | None |
| A0A2N5SVH5 | 1-143 | None |
| A0A5B0RH65 | 72-267 | None |
| A0A0L6UHY4 | 7-202 | None |
| A0A5B0NEC2 | 1-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.