DPCstruct | MC5799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0607 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F5Q3F0 | 31-148 | MPSCPEEQYWDPLLNACLSCRPICSHQTPRACAAFCKSLSCLKEQGRYYDQLLRDCVSCASICGRHPKQCTFFCENKLKSLMHPPPE… |
| A0A1S3F5C3 | 1-119 | MGSCPKEQYWNPLLHRCISCKLNCDHQNLSTCVAFCKSLKCPKEPGKYYYDHLLRKCVSCVSTCGQHPKQCTYFCENKLRSQTNLPP… |
| A0A3L8S248 | 13-157 | None |
| I3MV47 | 3-120 | None |
| H9G551 | 1-110 | None |
| A0A5E4BPA5 | 1-119 | None |
| A0A3Q0DHJ8 | 50-170 | None |
| A0A444UCB9 | 1-125 | None |
| G3U256 | 2-122 | None |
| A0A7E6EAR4 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.