DPCstruct | MC57988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 70 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9YUF2 | 247-303 | MTTDTALGVSKIVVEDGVPLEKIPYTDHPTITFNARESVEMPFRYIADAKGEPRLPP |
| A0A832XKH7 | 7-76 | FETRSLGNKQMPTDTAVYVAKKILEGKKLNDFKFVDELEIEINENESIVLPFRYVVDDNKLIISDKLVKY |
| E3KXA7 | 193-249 | None |
| A0A5N5QBX6 | 102-170 | None |
| A0A7C8J6K2 | 1-57 | None |
| A0A4T0P184 | 533-600 | None |
| A0A4Y9YMN3 | 49-129 | None |
| A0A2H9THU1 | 393-469 | None |
| A0A2G9LRM0 | 157-226 | None |
| A0A0B7FD86 | 113-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.