DPCstruct | MC57983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 261 ± 34 aa |
| Standard deviation of domain lengths | 34.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409WTF6 | 34-289 | QPHALYCKDSAIIQGGYFYLTGLMAATSCGIVCDFISRRSSPDVYRRYYPRLLRSVIDFYRLGLLEHKISPLEKSYEHLPKIHTFAG… |
| A0A067S3L0 | 174-426 | GHFILTHLMEITAQGLLHAFVLNEFITNTYHYPSRALFRRILDFCKKGLLEGKVKKISSAYSHIPDLDTLDGLINLLSLCNLVILGN… |
| A0A0C9WL70 | 69-395 | None |
| A0A6A4H2T7 | 19-252 | None |
| A0A6A4GZQ5 | 526-770 | None |
| A0A4Q2D7Z7 | 2-225 | None |
| A0A4Q2D1S6 | 761-1093 | None |
| A0A0C3CIX2 | 4-248 | None |
| A0A0D0BDH3 | 57-341 | None |
| A0A2H3ALH4 | 83-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.