DPCstruct | MC5798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 179 ± 23 aa |
| Standard deviation of domain lengths | 23.27 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14828 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6ZUU7 | 25-178 | GVEKVWLFNNNVLDPSNWENGTEATNCRGFLFPEVLGSVGSVTQLQTSAMVLPIMGELEIQNGGYIEFSDRDFCVRVKQIKPRHWLD… |
| A0A1S3EVH2 | 162-327 | RAADKVWVPNTGFETAANWNQNRTPCAGAAVQFPADKVVTVLVRENHAISDVLLPLDGELVLASGAGFRVAGDGPRPNCNAGGPAIF… |
| A0A803U1T1 | 2-196 | None |
| A0A6S7GSH8 | 27-219 | None |
| A0A1I7RXB0 | 17-180 | None |
| A0A1J1IFG3 | 63-270 | None |
| A0A195BAI5 | 201-371 | None |
| A0A183J6K7 | 21-212 | None |
| A0A2B4RDJ3 | 3-180 | None |
| A9UVE5 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.