DPCstruct | MC57971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U8BAI2 | 1-128 | MDGVIDNSGSAVPPLNYIIGRELEFKSKDTNGDMYMQGDHFFVSCFLKTHWTRKENSPYFFNNENYFIRTLLNKDHLILQSQKNKNI… |
| A0A3S4URA8 | 223-344 | QAILDNSCSPLPQLNYIVGRELGQGDATTLDKDLNIELFCKTFWNCDANSKHCFTPAHYKIRSLLNAEHLKIQAKYAKDTLFISYHS… |
| A0A698BXR6 | 24-136 | None |
| M5IRD4 | 636-779 | None |
| M1PJ97 | 199-316 | None |
| A0A825QTB6 | 124-224 | None |
| A0A7U8G453 | 103-233 | None |
| W4BBH8 | 201-333 | None |
| A0A825J0Z8 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.