DPCstruct | MC5797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 146 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 67.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15386 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A096LTX2 | 2-158 | FLLKVVKKHEEQKKVSSIRIRKTLPKPQTNLTPMGLPKPVRVKKKDFSLEEIYTNKNFSKPPESRLETIFEVPLNRKNGSESWFGPR… |
| A0A1S3ETW2 | 3-137 | KVSRFRIRRTPVRPQLKLTPMGLPRPIRLNKKEFSLEEIYTNKNYQSPTTRRTFETIFEEPRERNGTLILTSSKKLRRAVEFRDSSL… |
| A0A3P8X456 | 536-697 | None |
| A0A673Y7E8 | 802-955 | None |
| A0A670ZY79 | 262-419 | None |
| A0A6I9MWL2 | 1-127 | None |
| A0A4Z2BHH8 | 387-531 | None |
| A0A6G0HW57 | 380-526 | None |
| E7EYB5 | 908-1066 | None |
| A0A835P3M2 | 899-1045 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.