DPCstruct | MC57963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 76 ± 12 aa |
| Standard deviation of domain lengths | 11.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00864 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8I119 | 1-79 | EENAVFVMTNLILTQNQTQGHCPELPETSFCSKEQPCTPGYVGKQSNGVQTGKCVPYNSTVKTCEIFAWCPVENDTHVP |
| A0A819TA59 | 1-102 | MENNAFFIATRQTITYNQTQSICPTALADKSFCNDQNKTLCKTDEPTSSTFGFFTGNCVPSKENETIKVCEMNGWCPEELSDSIDYK… |
| A0A672FI95 | 92-170 | None |
| A0A183VSD3 | 101-182 | None |
| A0A6P8FTL5 | 170-263 | None |
| A0A2Y9E1E3 | 421-482 | None |
| A0A4Z2GI03 | 89-169 | None |
| A0A6I9PWX8 | 84-155 | None |
| A0A1D2NCG2 | 73-148 | None |
| A0A218UUT7 | 100-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.