DPCstruct | MC57959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 165 ± 23 aa |
| Standard deviation of domain lengths | 22.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817Z6Z1 | 9-169 | LDYQTIDCILSFFWNLSDRIVIVPWLLGIGLVKTMLECLQKIPISSETARQIISIIHNISRHDEGTDELNKFDGLVILKNIQSNNSE… |
| A0A819PWD8 | 1-184 | MLLILVNYSNKTVLVPCLIKTDYPRVLLTWLNVISKELSRDAGPLVGVIYNISRHDNGVQVLNSLDTTNKLREFQKHHQNSDINILC… |
| A0A817NIZ2 | 71-243 | None |
| A0A821MWD5 | 209-366 | None |
| A0A821SYE0 | 1-196 | None |
| A0A816QHS8 | 107-243 | None |
| A0A820URF4 | 15-159 | None |
| A0A819PRN8 | 65-233 | None |
| A0A818WGH7 | 77-281 | None |
| A0A814LX06 | 158-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.