DPCstruct | MC57958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5Q143 | 2-90 | EFVALIVRNGIYTKLKEELERIDENPNYMTVPAALRELEKIEMVRGHDQIYWLDHAVTKTQKVILKAFGMDVAYVKHRANRIIEQLK… |
| A0A1C6C821 | 10-98 | EFVAMILRCKMYTKLNEEMKNLEKKPNYMTVPEAFKELGKIEMVRQLDNVYRLDHAVTANQQTILNAFGLDANYIKYYASELSKELK… |
| A0A174GIJ1 | 2-84 | None |
| A0A3E3IBD0 | 8-99 | None |
| A0A395WA71 | 103-177 | None |
| E6LJA4 | 4-75 | None |
| A0A6I1EJT1 | 1-69 | None |
| U2BBJ0 | 40-131 | None |
| A0A1V5RKI6 | 40-121 | None |
| A0A564S905 | 19-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.