DPCstruct | MC57948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20153 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4HDS7 | 25-151 | LPTYDLSDDYEQRFPEDPMGEETGQNARVWRTYLAESADFDAMMVGEARDGLDAMLVFAGLFSAVVTSFLVQTSQNLQADFTETTAY… |
| A0A2H3D218 | 9-141 | VTSVHADDYEQRYPEVPPGSECGPMARIWRIFLDECQEFDAGRIEILRDSVDVLLVFAGLFSAAVTTFVAQMSQSLQTDYMRISASL… |
| A0A2H3D3E9 | 7-131 | None |
| A0A0D7BCE5 | 72-191 | None |
| A0A5B1QP49 | 104-225 | None |
| A0A2H3C8P3 | 56-178 | None |
| A0A1Q3E2S1 | 14-151 | None |
| A0A0D0CMP6 | 56-182 | None |
| A0A0D0CJ70 | 1-126 | None |
| A0A2H3B9W5 | 138-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.