DPCstruct | MC57945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 126 ± 20 aa |
| Standard deviation of domain lengths | 20.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1CXL9 | 1-120 | MASGSKNARTQRNLAPKERHRRMPFTHKKSHRANKYWDAVRILQDNGTRYLVEWYPDPVTGTRYPPTWEPHNYVTPALESEWKEMRT… |
| A0A4Q4MCK7 | 6-142 | TANKRKRTPNTSARSKRRRTTRLALTDASEPYRAHGSASEVFWAATRILEDNGTRYLVEWEGIDPGTGRPYEPTWEPHNFVTLALEA… |
| A0A6A6WLG2 | 148-273 | None |
| A0A4Q4QW61 | 10-163 | None |
| A0A2G5GKR1 | 127-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.