DPCstruct | MC5794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 179 ± 31 aa |
| Standard deviation of domain lengths | 31.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367Z6P2 | 6-177 | VLVRDMMFDLNPDMNPSLQFPLEEITTDEIWRRLHTQVFRLQGGFPEMYAITNGQASILGASFGGYGVIHMHVTDLDADGNPELTYA… |
| A0A1V5TUT7 | 1-244 | MKKAFCFVLVFALSAFLCACAAGGESTTAASAQTTTAAEKAQTVGTPCSKDGVDAFIAVLKEKQKQGSIEDFPFSGDLCYNVTPDSL… |
| A0A2D5W778 | 22-209 | None |
| A0A315Y0U0 | 540-719 | None |
| A0A1V5ML93 | 56-220 | None |
| A0A7C2LIY8 | 19-186 | None |
| A0A1R1G2I0 | 49-211 | None |
| A0A847EAK3 | 5-141 | None |
| A0A329KMA5 | 195-361 | None |
| A0A6N9P686 | 21-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.