DPCstruct | MC57927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5PGJ8 | 124-215 | VPDLNINKVAVVAVDDQTDLLELAKDKRWKTGYGIVLRPAAALPKPLVENTIYYLIRNTDKSSQLAKTRAEAHQQKSINLVGPIDGP… |
| M6TQ38 | 47-139 | HRVITGIVSATDRISCTSHGCVEGQLVKFSFTGGGVAALVNYYVRNPTTNDFQISATATGSIIDLTSSQTGDMITNIEYGFGDGSTT… |
| A0A431IQW0 | 60-152 | None |
| A0A0F9JZY8 | 66-165 | None |
| B4DA46 | 49-133 | None |
| A0A5C7Q1S7 | 417-517 | None |
| A0A5C7PYZ0 | 171-254 | None |
| A0A5C7PY75 | 98-193 | None |
| A0A2E5ZPA5 | 21-108 | None |
| A0A5C7PE43 | 124-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.